Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries) Uniprot P10824 |
Domain d1agra2: 1agr A:5-60,A:182-354 [32111] Other proteins in same PDB: d1agra1, d1agrd1, d1agre_, d1agrh_ complexed with alf, cit, gdp, mg |
PDB Entry: 1agr (more details), 2.8 Å
SCOPe Domain Sequences for d1agra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agra2 c.37.1.8 (A:5-60,A:182-354) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]} lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgi vethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
Timeline for d1agra2:
View in 3D Domains from other chains: (mouse over for more information) d1agrd1, d1agrd2, d1agre_, d1agrh_ |