Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) |
Family f.6.1.0: automated matches [227293] (1 protein) not a true family |
Protein automated matches [227114] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:367830] [321099] (1 PDB entry) |
Domain d5k59a_: 5k59 A: [321106] Other proteins in same PDB: d5k59e_, d5k59f1, d5k59f2, d5k59h_, d5k59l1, d5k59l2 automated match to d3lkfa_ complexed with cl, pg4, po4 |
PDB Entry: 5k59 (more details), 2.84 Å
SCOPe Domain Sequences for d5k59a_:
Sequence, based on SEQRES records: (download)
>d5k59a_ f.6.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]} eknldgdtkmytrtattsdsqknitqslqfnfltepnydketvfikakgtigsglrildp ngywnstlrwpgsysvsiqnvddnnntnvtdfapknqdesrevkytygyktggdfsinrg gltgnitkesnysetisyqqpsyrtlldqstshkgvgwkveahlinnmghdhtrqltnds dnrtkseifsltrngnlwakdnftpkdkmpvtvsegfnpeflavmshdkkdkgksqfvvh ykrsmdefkidwnrhgfwgywsgenhvdkkeeklsalyevdwkthnvkfvkvlnd
>d5k59a_ f.6.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]} eknldgdtkmytrtattsdsqknitqslqfnfltepnydketvfikakgtigsglrildp ngywnstlrwpgsysvsiqnvddnnntnvtdfapknqdesrevkytygyktggdfsinlt gnitkesnysetisyqqpsyrtlldqstshkgvgwkveahlinnmghdhtrqltndsdnr tkseifsltrngnlwakdnftpkdkmpvtvsegfnpeflavmshdkkdkgksqfvvhykr smdefkidwnrhgfwgywsgenhvdkkeeklsalyevdwkthnvkfvkvlnd
Timeline for d5k59a_: