SCOPe 2.06: Domain d5jpaa1: 5jpa A:1-147

Lineage for d5jpaa1 (5jpa A:1-147)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)

8. Domain d5jpaa1: 5jpa A:1-147 [321101]
   Other proteins in same PDB: d5jpaa2
   automated match to d4xfxa1
   mutant

Details for d5jpaa1

PDB Entry: 5jpa, 1.7 Å

PDB Description: hexameric hiv-1 ca h12y mutant

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5jpaa1:

Sequence, based on SEQRES records:

>d5jpaa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvyqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d5jpaa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvyqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpviapgqmreprgsdiagttstlqeqigwmthnppi
pvgeiykrwiilglnkivrmysp

Timeline for d5jpaa1:

• d5jpaa1 is new in SCOPe 2.06-stable
  
• d5jpaa1 appears in SCOPe 2.07
  
• d5jpaa1 appears in the current release, SCOPe 2.08