SCOPe 2.03: Domain d1as2a2: 1as2 A:32-60,A:182-346

Lineage for d1as2a2 (1as2 A:32-60,A:182-346)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
   Uniprot P10824

8. Domain d1as2a2: 1as2 A:32-60,A:182-346 [32110]
   Other proteins in same PDB: d1as2a1
   complexed with gdp, po4

Details for d1as2a2

PDB Entry: 1as2, 2.8 Å

PDB Description: gdp+pi bound g42v gia1

PDB Compounds: (A:) gia1

SCOPe Domain Sequences for d1as2a2:

Sequence; same for both SEQRES and ATOM records:

>d1as2a2 c.37.1.8 (A:32-60,A:182-346) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
revkllllgavesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviikn

Timeline for d1as2a2:

• d1as2a2 first appeared (with stable ids) in SCOP 1.55, called d1as2_2
  
• d1as2a2 appears in SCOPe 2.02
  
• d1as2a2 appears in SCOPe 2.04
  
• d1as2a2 appears in the current release, SCOPe 2.08