Lineage for d5ik5a1 (5ik5 A:2740-2932)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779614Protein automated matches [190380] (3 species)
    not a true protein
  7. 2779620Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries)
  8. 2779623Domain d5ik5a1: 5ik5 A:2740-2932 [321097]
    automated match to d1dyka1
    complexed with 4mu, ca, gol

Details for d5ik5a1

PDB Entry: 5ik5 (more details), 1.39 Å

PDB Description: laminin a2lg45 c-form, g6/7 bound.
PDB Compounds: (A:) laminin subunit alpha-2

SCOPe Domain Sequences for d5ik5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ik5a1 b.29.1.4 (A:2740-2932) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ptmvhgpcvaesepalltgskqfglsrnshiaiafddtkvknrltielevrteaesgllf
ymarinhadfatvqlrngfpyfsydlgsgdtstmiptkindgqwhkikivrvkqegilyv
ddassqtispkkadildvvgilyvgglpinyttrrigpvtysldgcvrnlhmeqapvdld
qptssfhvgtcfa

SCOPe Domain Coordinates for d5ik5a1:

Click to download the PDB-style file with coordinates for d5ik5a1.
(The format of our PDB-style files is described here.)

Timeline for d5ik5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ik5a2