SCOPe 2.08: Domain d5jowa1: 5jow A:21-322

Lineage for d5jowa1 (5jow A:21-322)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.0: automated matches [227228] (1 protein)
   not a true family

6. Protein automated matches [226971] (7 species)
   not a true protein

7. Species Bacteroides ovatus [TaxId:411476] [321040] (1 PDB entry)

8. Domain d5jowa1: 5jow A:21-322 [321041]
   Other proteins in same PDB: d5jowa2, d5jowa3, d5jowb2, d5jowb3
   automated match to d1yrza2
   complexed with edo, trs

Details for d5jowa1

PDB Entry: 5jow, 1.6 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43a

PDB Compounds: (A:) Non-reducing end alpha-L-arabinofuranosidase BoGH43A

SCOPe Domain Sequences for d5jowa1:

Sequence; same for both SEQRES and ATOM records:

>d5jowa1 b.67.2.0 (A:21-322) automated matches {Bacteroides ovatus [TaxId: 411476]}
qgysnpvipgfhpdpsvckagddyylvnssfqyfpgvplfhskdlvhweqigncltrpsq
ldltnansgsgifaptiryndgvfymittnvsgkgnflvhttdprsewsepvwleqggid
pslyfedgkcfmvsnpdgyinlceidpmtgkqlssskriwngtggryaegphiykkdgwy
ylliseggtelghkvtiarsryidgpyqgnpanpilthanesgqsspiqgtghadlvegt
dgswwmvclayrimpgthhtlgretylapvrwdkdawpvvnsngtislkmdvptlpqqem
kg

Timeline for d5jowa1:

• d5jowa1 first appeared in SCOPe 2.06
  
• d5jowa1 appears in SCOPe 2.07