SCOP 1.55: Domain d1fqkc2: 1fqk C:29-60,C:182-345

Lineage for d1fqkc2 (1fqk C:29-60,C:182-345)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein Transducin (alpha subunit) [52623] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries)

8. Domain d1fqkc2: 1fqk C:29-60,C:182-345 [32104]
   Other proteins in same PDB: d1fqka1, d1fqkb_, d1fqkc1, d1fqkd_

Details for d1fqkc2

PDB Entry: 1fqk, 2.3 Å

PDB Description: crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)- (alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqkc2:

Sequence; same for both SEQRES and ATOM records:

>d1fqkc2 c.37.1.8 (C:29-60,C:182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
tvkllllgagesgkstivkqmkiihqdgysleXetqfsfkdlnfrmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqnv
kfvfdavtdiiikenlk

Timeline for d1fqkc2:

• d1fqkc2 appears in SCOP 1.57
  
• d1fqkc2 appears in the current release, SCOPe 2.08