Lineage for d5fvna_ (5fvn A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2575890Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2575961Protein automated matches [190289] (6 species)
    not a true protein
  7. 2575965Species Enterobacter cloacae [TaxId:550] [320989] (1 PDB entry)
  8. 2575966Domain d5fvna_: 5fvn A: [321033]
    automated match to d2j1na_
    complexed with c8e, ca, dao, ftt, kdo, myr, po4, so4

Details for d5fvna_

PDB Entry: 5fvn (more details), 1.45 Å

PDB Description: x-ray crystal structure of enterobacter cloacae ompe36 porin
PDB Compounds: (A:) ompc porin

SCOPe Domain Sequences for d5fvna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvna_ f.4.3.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
aeiynkdgnkldlygkvdglhyfsdddsqdgdqtymrlgfkgetqvndqltgygqweyqi
qgnsgenennswtrvafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdnf
mqqrgngfatyrnsdffglvdglnfavqyqgkngsasgedqtnngrtelrqngdgvggsi
tynlgegfgigtavssskrtssqndltygngdraetytgglkydanniylaaqytqtyna
trvgnlgwankaqnfevvaqyqfdfglrpsvaylqskgkdlengygdqdllkyvdvgaty
yfnknmstyvdykinllddkeftrnagistddivalglvyqf

SCOPe Domain Coordinates for d5fvna_:

Click to download the PDB-style file with coordinates for d5fvna_.
(The format of our PDB-style files is described here.)

Timeline for d5fvna_: