Lineage for d1gfi_2 (1gfi 33-60,182-345)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69860Protein Transducin (alpha subunit) [52623] (2 species)
  7. 69878Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries)
  8. 69885Domain d1gfi_2: 1gfi 33-60,182-345 [32102]
    Other proteins in same PDB: d1gfi_1

Details for d1gfi_2

PDB Entry: 1gfi (more details), 2.2 Å

PDB Description: structures of active conformations of gi alpha 1 and the mechanism of gtp hydrolysis

SCOP Domain Sequences for d1gfi_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gfi_2 c.37.1.8 (33-60,182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
qfvfdavtdviik

SCOP Domain Coordinates for d1gfi_2:

Click to download the PDB-style file with coordinates for d1gfi_2.
(The format of our PDB-style files is described here.)

Timeline for d1gfi_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gfi_1