SCOPe 2.06: Domain d5cxaa_: 5cxa A:

Lineage for d5cxaa_ (5cxa A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (47 PDB entries)

8. Domain d5cxaa_: 5cxa A: [321000]
   automated match to d4i03a_
   complexed with 55l, ca, zn

Details for d5cxaa_

PDB Entry: 5cxa, 1.3 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 in complex with a carboxylate inhibitor related to rxp470

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d5cxaa_:

Sequence; same for both SEQRES and ATOM records:

>d5cxaa_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptyayvdintfrlsaddirgiqslyg

Timeline for d5cxaa_:

• d5cxaa_ is new in SCOPe 2.06-stable
  
• d5cxaa_ appears in SCOPe 2.07
  
• d5cxaa_ appears in the current release, SCOPe 2.08