Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (2 species) common fold is interrupted with an all-alpha domain |
Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (20 PDB entries) |
Domain d1fqja2: 1fqj A:28-60,A:182-344 [32098] Other proteins in same PDB: d1fqja1, d1fqjb_, d1fqjc_, d1fqjd1, d1fqje_ |
PDB Entry: 1fqj (more details), 2.02 Å
SCOP Domain Sequences for d1fqja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqja2 c.37.1.8 (A:28-60,A:182-344) Transducin (alpha subunit) {Rat (Rattus norvegicus)} rtvkllllgagesgkstivkqmkiihqdgysleXetqfsfkdlnfrmfdvggqrserkkw ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk dlfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqn vkfvfdavtdiiikenl
Timeline for d1fqja2: