SCOPe 2.06: Domain d5b85a_: 5b85 A:

Lineage for d5b85a_ (5b85 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (267 PDB entries)
   Uniprot P02185

8. Domain d5b85a_: 5b85 A: [320976]
   automated match to d4pnja_
   complexed with hem

Details for d5b85a_

PDB Entry: 5b85, 1.85 Å

PDB Description: x-ray structure of ferric f138y sperm whale myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5b85a_:

Sequence; same for both SEQRES and ATOM records:

>d5b85a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelyrkdiaakykelgyqg

Timeline for d5b85a_:

• d5b85a_ is new in SCOPe 2.06-stable
  
• d5b85a_ appears in SCOPe 2.07
  
• d5b85a_ appears in the current release, SCOPe 2.08