Lineage for d5cjpd_ (5cjp D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125340Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)
  8. 2125650Domain d5cjpd_: 5cjp D: [320974]
    automated match to d1ajea_
    complexed with gtp, mg

Details for d5cjpd_

PDB Entry: 5cjp (more details), 2.6 Å

PDB Description: the structural basis for cdc42-induced dimerization of iqgaps
PDB Compounds: (D:) Cell division cycle 42 (GTP binding protein, 25kDa), isoform CRA_a

SCOPe Domain Sequences for d5cjpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cjpd_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal

SCOPe Domain Coordinates for d5cjpd_:

Click to download the PDB-style file with coordinates for d5cjpd_.
(The format of our PDB-style files is described here.)

Timeline for d5cjpd_: