Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) |
Family c.37.1.8: G proteins [52592] (20 proteins) |
Protein Transducin (alpha subunit) [52623] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries) |
Domain d1bh2_2: 1bh2 32-60,182-346 [32097] Other proteins in same PDB: d1bh2_1 |
PDB Entry: 1bh2 (more details), 2.1 Å
SCOP Domain Sequences for d1bh2_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh2_2 c.37.1.8 (32-60,182-346) Transducin (alpha subunit) {Rat (Rattus norvegicus)} revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcstdtkn vqfvfdavtdviikn
Timeline for d1bh2_2: