SCOP 1.59: Domain d1gia_2: 1gia 34-60,182-343

Lineage for d1gia_2 (1gia 34-60,182-343)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.8: G proteins [52592] (23 proteins)

6. Protein Transducin (alpha subunit) [52623] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries)

8. Domain d1gia_2: 1gia 34-60,182-343 [32094]
   Other proteins in same PDB: d1gia_1

Details for d1gia_2

PDB Entry: 1gia, 2 Å

PDB Description: structure of active conformations of gia1 and the mechanism of gtp hydrolysis

SCOP Domain Sequences for d1gia_2:

Sequence; same for both SEQRES and ATOM records:

>d1gia_2 c.37.1.8 (34-60,182-343) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwih
cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
fvfdavtdvi

Timeline for d1gia_2:

• d1gia_2 first appeared (with stable ids) in SCOP 1.55
  
• d1gia_2 appears in SCOP 1.57
  
• d1gia_2 appears in SCOP 1.61
  
• d1gia_2 appears in the current release, SCOPe 2.08, called d1giaa2