Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5jhrf_: 5jhr F: [320927] Other proteins in same PDB: d5jhra_, d5jhrc1, d5jhrc2, d5jhrd_, d5jhre_, d5jhrg_, d5jhri_, d5jhrj_, d5jhrk_, d5jhrl_, d5jhrn_, d5jhro_, d5jhrq1, d5jhrq2, d5jhrr_, d5jhrs_, d5jhru_, d5jhrw_, d5jhrx_, d5jhry_, d5jhrz_ automated match to d4g4sg_ complexed with 6kf, cl, mes, mg |
PDB Entry: 5jhr (more details), 2.9 Å
SCOPe Domain Sequences for d5jhrf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhrf_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d5jhrf_:
View in 3D Domains from other chains: (mouse over for more information) d5jhra_, d5jhrb_, d5jhrc1, d5jhrc2, d5jhrd_, d5jhre_, d5jhrg_, d5jhrh_, d5jhri_, d5jhrj_, d5jhrk_, d5jhrl_, d5jhrm_, d5jhrn_, d5jhro_, d5jhrp_, d5jhrq1, d5jhrq2, d5jhrr_, d5jhrs_, d5jhrt_, d5jhru_, d5jhrv_, d5jhrw_, d5jhrx_, d5jhry_, d5jhrz_ |