Lineage for d5jhrf_ (5jhr F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994901Domain d5jhrf_: 5jhr F: [320927]
    Other proteins in same PDB: d5jhra_, d5jhrc1, d5jhrc2, d5jhrd_, d5jhre_, d5jhrg_, d5jhri_, d5jhrj_, d5jhrk_, d5jhrl_, d5jhrn_, d5jhro_, d5jhrq1, d5jhrq2, d5jhrr_, d5jhrs_, d5jhru_, d5jhrw_, d5jhrx_, d5jhry_, d5jhrz_
    automated match to d4g4sg_
    complexed with 6kf, cl, mes, mg

Details for d5jhrf_

PDB Entry: 5jhr (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 27
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5jhrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhrf_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5jhrf_:

Click to download the PDB-style file with coordinates for d5jhrf_.
(The format of our PDB-style files is described here.)

Timeline for d5jhrf_: