Lineage for d1aztb2 (1azt B:35-69,B:202-391)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23317Protein Transducin (alpha subunit) [52623] (2 species)
  7. 23318Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)
  8. 23328Domain d1aztb2: 1azt B:35-69,B:202-391 [32085]
    Other proteins in same PDB: d1azta1, d1aztb1

Details for d1aztb2

PDB Entry: 1azt (more details), 2.3 Å

PDB Description: gs-alpha complexed with gtp-gamma-s

SCOP Domain Sequences for d1aztb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aztb2 c.37.1.8 (B:35-69,B:202-391) Transducin (alpha subunit) {Cow (Bos taurus)}
qvyrathrllllgagesgkstivkqmrilhvngfnXvltsgifetkfqvdkvnfhmfdvg
gqrderrkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrti
svilflnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdef
lristasgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqy

SCOP Domain Coordinates for d1aztb2:

Click to download the PDB-style file with coordinates for d1aztb2.
(The format of our PDB-style files is described here.)

Timeline for d1aztb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aztb1