SCOPe 2.03: Domain d1taga2: 1tag A:27-56,A:178-340

Lineage for d1taga2 (1tag A:27-56,A:178-340)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
   Uniprot P04896 39-388

8. Domain d1taga2: 1tag A:27-56,A:178-340 [32080]
   Other proteins in same PDB: d1taga1
   complexed with gdp, mg

Details for d1taga2

PDB Entry: 1tag, 1.8 Å

PDB Description: structural determinants for activation of the alpha-subunit of a heterotrimeric g protein

PDB Compounds: (A:) transducin-alpha

SCOPe Domain Sequences for d1taga2:

Sequence; same for both SEQRES and ATOM records:

>d1taga2 c.37.1.8 (A:27-56,A:178-340) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiii

Timeline for d1taga2:

• d1taga2 first appeared (with stable ids) in SCOP 1.55, called d1tag_2
  
• d1taga2 appears in SCOPe 2.02
  
• d1taga2 appears in SCOPe 2.04
  
• d1taga2 appears in the current release, SCOPe 2.08