Lineage for d1tag_2 (1tag 27-56,178-340)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Transducin (alpha subunit) [52623] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries) 
Domain d1tag_2: 1tag 27-56,178-340 [32080]
Other proteins in same PDB: d1tag_1
Details for d1tag_2
PDB Entry: 1tag (more details), 1.8 Å
PDB Description: structural determinants for activation of the alpha-subunit of a heterotrimeric g protein
SCOP Domain Sequences for d1tag_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tag_2 c.37.1.8 (27-56,178-340) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiii
SCOP Domain Coordinates for d1tag_2:
Click to download the PDB-style file with coordinates for d1tag_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tag_2:
- d1tag_2 first appeared (with stable ids) in SCOP 1.55
- d1tag_2 appears in SCOP 1.59
- d1tag_2 appears in the current release, SCOPe 2.08, called d1taga2
View in 3D
