SCOPe 2.05: Domain d1tadc2: 1tad C:27-56,C:178-344

Lineage for d1tadc2 (1tad C:27-56,C:178-344)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
   Uniprot P04896 39-388

8. Domain d1tadc2: 1tad C:27-56,C:178-344 [32079]
   Other proteins in same PDB: d1tada1, d1tadb1, d1tadc1
   complexed with alf, ca, cac, gdp

Details for d1tadc2

PDB Entry: 1tad, 1.7 Å

PDB Description: gtpase mechanism of gproteins from the 1.7-angstrom crystal structure of transducin alpha-gdp-alf4-

PDB Compounds: (C:) transducin-alpha

SCOPe Domain Sequences for d1tadc2:

Sequence; same for both SEQRES and ATOM records:

>d1tadc2 c.37.1.8 (C:27-56,C:178-344) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiikenl

Timeline for d1tadc2:

• d1tadc2 first appeared (with stable ids) in SCOP 1.55
  
• d1tadc2 appears in SCOPe 2.04
  
• d1tadc2 appears in SCOPe 2.06
  
• d1tadc2 appears in the current release, SCOPe 2.08