SCOPe 2.03: Domain d1ek0a_: 1ek0 A:

Lineage for d1ek0a_ (1ek0 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ypt51 [52621] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52622] (1 PDB entry)

8. Domain d1ek0a_: 1ek0 A: [32076]
   complexed with gdp, gnp, mg, ni

Details for d1ek0a_

PDB Entry: 1ek0, 1.48 Å

PDB Description: gppnhp-bound ypt51 at 1.48 a resolution

PDB Compounds: (A:) protein (GTP-binding protein ypt51)

SCOPe Domain Sequences for d1ek0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtsiklvllgeaavgkssivlrfvsndfaenkeptigaafltqrvtinehtvkfeiwdta
gqerfaslapmyyrnaqaalvvydvtkpqsfikarhwvkelheqaskdiiialvgnkidm
lqeggerkvareegeklaeekgllffetsaktgenvndvflgigekiplk

Timeline for d1ek0a_:

• d1ek0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ek0a_ appears in SCOPe 2.02
  
• d1ek0a_ appears in SCOPe 2.04
  
• d1ek0a_ appears in the current release, SCOPe 2.08