Lineage for d5l9dl1 (5l9d L:2-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034811Domain d5l9dl1: 5l9d L:2-107 [320634]
    Other proteins in same PDB: d5l9dl2
    automated match to d1a5fl1
    complexed with k, nag, pe8, peg, pg4, pge

Details for d5l9dl1

PDB Entry: 5l9d (more details), 1.88 Å

PDB Description: afamin antibody fragment, n14 fab, l1- glycosylated, crystal form i, parsimonious model
PDB Compounds: (L:) Mouse Antibody Fab Fragment, IgG1-kappa Light Chain

SCOPe Domain Sequences for d5l9dl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l9dl1 b.1.1.0 (L:2-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivltqtpaimsaslgervtmtctanssvssnyfhwyqqkpgsspklwiystsnlasgvpt
rfsgsgsgtsysltlssmeaedaatyychqyhrspptfgsgtklkmk

SCOPe Domain Coordinates for d5l9dl1:

Click to download the PDB-style file with coordinates for d5l9dl1.
(The format of our PDB-style files is described here.)

Timeline for d5l9dl1: