SCOP 1.71: Domain d1fzqa_: 1fzq A:

Lineage for d1fzqa_ (1fzq A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (8 species)

7. Species Mouse (Mus musculus), ARL3 [TaxId:10090] [52618] (1 PDB entry)

8. Domain d1fzqa_: 1fzq A: [32060]
   complexed with gdp, mes, nh4, so4

Details for d1fzqa_

PDB Entry: 1fzq, 1.7 Å

PDB Description: crystal structure of murine arl3-gdp

SCOP Domain Sequences for d1fzqa_:

Sequence; same for both SEQRES and ATOM records:

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3}
gllsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgf
klnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpv
lifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv

Timeline for d1fzqa_:

• d1fzqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fzqa_ appears in SCOP 1.69
  
• d1fzqa_ appears in SCOP 1.73
  
• d1fzqa_ appears in the current release, SCOPe 2.08