Lineage for d5jhrq1 (5jhr Q:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996277Domain d5jhrq1: 5jhr Q:1-234 [320599]
    Other proteins in same PDB: d5jhra_, d5jhrb_, d5jhrc2, d5jhrf_, d5jhrg_, d5jhrh_, d5jhri_, d5jhrj_, d5jhrk_, d5jhrl_, d5jhrm_, d5jhrn_, d5jhro_, d5jhrp_, d5jhrq2, d5jhrt_, d5jhru_, d5jhrv_, d5jhrw_, d5jhrx_, d5jhry_, d5jhrz_
    automated match to d1iruf_
    complexed with 6kf, cl, mes, mg

Details for d5jhrq1

PDB Entry: 5jhr (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 27
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5jhrq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhrq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d5jhrq1:

Click to download the PDB-style file with coordinates for d5jhrq1.
(The format of our PDB-style files is described here.)

Timeline for d5jhrq1: