Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (8 species) |
Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (2 PDB entries) |
Domain d1hfvb_: 1hfv B: [32059] complexed with gsp, mg |
PDB Entry: 1hfv (more details), 2.8 Å
SCOP Domain Sequences for d1hfvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfvb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF6} nkemrilmlgldaagkttilyklklgqsvttiptlgfnvetvtyknvkfnvwdvggqdki rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk
Timeline for d1hfvb_: