SCOP 1.71: Domain d1hfvb_: 1hfv B:

Lineage for d1hfvb_ (1hfv B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (8 species)

7. Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (2 PDB entries)

8. Domain d1hfvb_: 1hfv B: [32059]
   complexed with gsp, mg

Details for d1hfvb_

PDB Entry: 1hfv, 2.8 Å

PDB Description: structure of the small g protein arf6 in complex with gtpgammas

SCOP Domain Sequences for d1hfvb_:

Sequence; same for both SEQRES and ATOM records:

>d1hfvb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF6}
nkemrilmlgldaagkttilyklklgqsvttiptlgfnvetvtyknvkfnvwdvggqdki
rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk

Timeline for d1hfvb_:

• d1hfvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hfvb_ appears in SCOP 1.69
  
• d1hfvb_ does not appear in SCOP 1.73