Lineage for d1e0sa_ (1e0s A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124193Protein ADP-ribosylation factor [52614] (16 species)
  7. 2124231Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)
  8. 2124234Domain d1e0sa_: 1e0s A: [32057]
    complexed with bme, gdp, nh4

Details for d1e0sa_

PDB Entry: 1e0s (more details), 2.28 Å

PDB Description: small g protein arf6-gdp
PDB Compounds: (A:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d1e0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
gkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnv
wdvggqdkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifa
nkqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk

SCOPe Domain Coordinates for d1e0sa_:

Click to download the PDB-style file with coordinates for d1e0sa_.
(The format of our PDB-style files is described here.)

Timeline for d1e0sa_: