Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (16 species) |
Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries) |
Domain d1e0sa_: 1e0s A: [32057] complexed with bme, gdp, nh4 |
PDB Entry: 1e0s (more details), 2.28 Å
SCOPe Domain Sequences for d1e0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} gkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnv wdvggqdkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifa nkqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk
Timeline for d1e0sa_: