Lineage for d5jhrc_ (5jhr C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230932Domain d5jhrc_: 5jhr C: [320561]
    Other proteins in same PDB: d5jhra_, d5jhrb_, d5jhrf_, d5jhrg_, d5jhrh_, d5jhri_, d5jhrj_, d5jhrk_, d5jhrl_, d5jhrm_, d5jhrn_, d5jhro_, d5jhrp_, d5jhrt_, d5jhru_, d5jhrv_, d5jhrw_, d5jhrx_, d5jhry_, d5jhrz_
    automated match to d1iruf_
    complexed with 6kf, cl, mes, mg

Details for d5jhrc_

PDB Entry: 5jhr (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 27
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5jhrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhrc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5jhrc_:

Click to download the PDB-style file with coordinates for d5jhrc_.
(The format of our PDB-style files is described here.)

Timeline for d5jhrc_: