SCOPe 2.06: Domain d1rrfa_: 1rrf A:

Lineage for d1rrfa_ (1rrf A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Norway rat (Rattus norvegicus), ARF1 [TaxId:10116] [52616] (2 PDB entries)

8. Domain d1rrfa_: 1rrf A: [32056]
   complexed with gdp, mg

Details for d1rrfa_

PDB Entry: 1rrf, 3 Å

PDB Description: non-myristoylated rat adp-ribosylation factor-1 complexed with gdp, monomeric crystal form

PDB Compounds: (A:) rat ADP-ribosylation factor-1

SCOPe Domain Sequences for d1rrfa_:

Sequence, based on SEQRES records:

>d1rrfa_ c.37.1.8 (A:) ADP-ribosylation factor {Norway rat (Rattus norvegicus), ARF1 [TaxId: 10116]}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlr

Sequence, based on observed residues (ATOM records):

>d1rrfa_ c.37.1.8 (A:) ADP-ribosylation factor {Norway rat (Rattus norvegicus), ARF1 [TaxId: 10116]}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrfqntqglifvvdsndrervneareelmrmlaedelrdavllv
fankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlr

Timeline for d1rrfa_:

• d1rrfa_ first appeared (with stable ids) in SCOP 1.55, called d1rrf__
  
• d1rrfa_ appears in SCOPe 2.05
  
• d1rrfa_ appears in SCOPe 2.07
  
• d1rrfa_ appears in the current release, SCOPe 2.08