SCOPe 2.08: Domain d5kbnc_: 5kbn C:

Lineage for d5kbnc_ (5kbn C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d5kbnc_: 5kbn C: [320555]
   automated match to d5a43c_
   complexed with dmu, f, na; mutant

Details for d5kbnc_

PDB Entry: 5kbn, 2.48 Å

PDB Description: the crystal structure of fluoride channel fluc ec2 f80i mutant

PDB Compounds: (C:) monobody

SCOPe Domain Sequences for d5kbnc_:

Sequence; same for both SEQRES and ATOM records:

>d5kbnc_ b.1.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt

Timeline for d5kbnc_:

• d5kbnc_ first appeared in SCOPe 2.06
  
• d5kbnc_ appears in SCOPe 2.07