Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d5kvgl2: 5kvg L:108-214 [320546] Other proteins in same PDB: d5kvge_, d5kvgh_, d5kvgl1 automated match to d12e8l2 complexed with cl |
PDB Entry: 5kvg (more details), 1.4 Å
SCOPe Domain Sequences for d5kvgl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kvgl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d5kvgl2: