Lineage for d5kvgl2 (5kvg L:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752341Domain d5kvgl2: 5kvg L:108-214 [320546]
    Other proteins in same PDB: d5kvge_, d5kvgh_, d5kvgl1
    automated match to d12e8l2
    complexed with cl

Details for d5kvgl2

PDB Entry: 5kvg (more details), 1.4 Å

PDB Description: zika specific antibody, zv-67, bound to zika envelope diii
PDB Compounds: (L:) ZV-67 Antibody Fab Light Chain

SCOPe Domain Sequences for d5kvgl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvgl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5kvgl2:

Click to download the PDB-style file with coordinates for d5kvgl2.
(The format of our PDB-style files is described here.)

Timeline for d5kvgl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kvgl1