SCOPe 2.06: Domain d5kvgl1: 5kvg L:1-107

Lineage for d5kvgl1 (5kvg L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)

8. Domain d5kvgl1: 5kvg L:1-107 [320545]
   Other proteins in same PDB: d5kvge_, d5kvgl2
   automated match to d12e8l1
   complexed with cl

Details for d5kvgl1

PDB Entry: 5kvg, 1.4 Å

PDB Description: zika specific antibody, zv-67, bound to zika envelope diii

PDB Compounds: (L:) ZV-67 Antibody Fab Light Chain

SCOPe Domain Sequences for d5kvgl1:

Sequence; same for both SEQRES and ATOM records:

>d5kvgl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqfssypytfgggtkleik

Timeline for d5kvgl1:

• d5kvgl1 is new in SCOPe 2.06-stable
  
• d5kvgl1 appears in SCOPe 2.07
  
• d5kvgl1 appears in the current release, SCOPe 2.08