Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d5jhre_: 5jhr E: [320541] Other proteins in same PDB: d5jhra_, d5jhrb_, d5jhrf_, d5jhrg_, d5jhrh_, d5jhri_, d5jhrj_, d5jhrk_, d5jhrl_, d5jhrm_, d5jhrn_, d5jhro_, d5jhrp_, d5jhrt_, d5jhru_, d5jhrv_, d5jhrw_, d5jhrx_, d5jhry_, d5jhrz_ automated match to d4g4se_ complexed with 6kf, cl, mes, mg |
PDB Entry: 5jhr (more details), 2.9 Å
SCOPe Domain Sequences for d5jhre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhre_ d.153.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
Timeline for d5jhre_: