![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein ADP-ribosylation factor [52614] (8 species) |
![]() | Species Rat (Rattus norvegicus), ARF1 [TaxId:10116] [52616] (2 PDB entries) |
![]() | Domain d1rrga_: 1rrg A: [32054] |
PDB Entry: 1rrg (more details), 2.4 Å
SCOP Domain Sequences for d1rrga_:
Sequence, based on SEQRES records: (download)
>d1rrga_ c.37.1.8 (A:) ADP-ribosylation factor {Rat (Rattus norvegicus), ARF1} gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
>d1rrga_ c.37.1.8 (A:) ADP-ribosylation factor {Rat (Rattus norvegicus), ARF1} gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni sftvwdvggirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvf ankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
Timeline for d1rrga_: