SCOPe 2.08: Domain d5jw5l2: 5jw5 L:103-209

Lineage for d5jw5l2 (5jw5 L:103-209)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5jw5l2: 5jw5 L:103-209 [320528]
Other proteins in same PDB: d5jw5a1, d5jw5a2, d5jw5b1, d5jw5h1, d5jw5h2, d5jw5l1
automated match to d1dn0a2
complexed with po4

Details for d5jw5l2

PDB Entry: 5jw5 (more details), 1.9 Å

PDB Description: structure of medi8852 fab fragment

PDB Compounds: (L:) MEDI8852 Light chain

SCOPe Domain Sequences for d5jw5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jw5l2 b.1.1.2 (L:103-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5jw5l2:

Click to download the PDB-style file with coordinates for d5jw5l2.
(The format of our PDB-style files is described here.)

Timeline for d5jw5l2: