SCOPe 2.08: Domain d5exbd1: 5exb D:3-225

Lineage for d5exbd1 (5exb D:3-225)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Dendronephthya sp. [TaxId:51110] [320282] (1 PDB entry)

8. Domain d5exbd1: 5exb D:3-225 [320525]
   Other proteins in same PDB: d5exbb2, d5exbc2, d5exbd2, d5exbg2, d5exbk2, d5exbl2
   automated match to d3svna_
   complexed with gol

Details for d5exbd1

PDB Entry: 5exb, 1.81 Å

PDB Description: wild type green fluorescent protein dendfp (dendronephthya sp.)

PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d5exbd1:

Sequence; same for both SEQRES and ATOM records:

>d5exbd1 d.22.1.0 (D:3-225) automated matches {Dendronephthya sp. [TaxId: 51110]}
likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw

Timeline for d5exbd1:

• d5exbd1 first appeared in SCOPe 2.06
  
• d5exbd1 appears in SCOPe 2.07