Lineage for d5kvfe_ (5kvf E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038954Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2038998Protein automated matches [190183] (7 species)
    not a true protein
  7. 2039018Species Zika virus [TaxId:64320] [320471] (5 PDB entries)
  8. 2039020Domain d5kvfe_: 5kvf E: [320523]
    Other proteins in same PDB: d5kvfl1, d5kvfl2
    automated match to d1s6na_
    complexed with gol

Details for d5kvfe_

PDB Entry: 5kvf (more details), 1.4 Å

PDB Description: zika specific antibody, zv-64, bound to zika envelope diii
PDB Compounds: (E:) ZIKA Envelope DIII

SCOPe Domain Sequences for d5kvfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvfe_ b.1.18.4 (E:) automated matches {Zika virus [TaxId: 64320]}
vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
pvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti

SCOPe Domain Coordinates for d5kvfe_:

Click to download the PDB-style file with coordinates for d5kvfe_.
(The format of our PDB-style files is described here.)

Timeline for d5kvfe_: