Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein automated matches [190183] (7 species) not a true protein |
Species Zika virus [TaxId:64320] [320471] (5 PDB entries) |
Domain d5kvfe_: 5kvf E: [320523] Other proteins in same PDB: d5kvfl1, d5kvfl2 automated match to d1s6na_ complexed with gol |
PDB Entry: 5kvf (more details), 1.4 Å
SCOPe Domain Sequences for d5kvfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kvfe_ b.1.18.4 (E:) automated matches {Zika virus [TaxId: 64320]} vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan pvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti
Timeline for d5kvfe_: