SCOP 1.73: Domain d1hura_: 1hur A:

Lineage for d1hura_ (1hur A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (14 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (9 PDB entries)

8. Domain d1hura_: 1hur A: [32052]

Details for d1hura_

PDB Entry: 1hur, 2 Å

PDB Description: human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated

PDB Compounds: (A:) human ADP-ribosylation factor 1

SCOP Domain Sequences for d1hura_:

Sequence; same for both SEQRES and ATOM records:

>d1hura_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

Timeline for d1hura_:

• d1hura_ first appeared (with stable ids) in SCOP 1.55
  
• d1hura_ appears in SCOP 1.71
  
• d1hura_ appears in SCOP 1.75
  
• d1hura_ appears in the current release, SCOPe 2.08