| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (8 species) |
| Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (8 PDB entries) |
| Domain d1hura_: 1hur A: [32052] |
PDB Entry: 1hur (more details), 2 Å
SCOP Domain Sequences for d1hura_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hura_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
Timeline for d1hura_: