SCOPe 2.06: Domain d5kvfl2: 5kvf L:108-214

Lineage for d5kvfl2 (5kvf L:108-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d5kvfl2: 5kvf L:108-214 [320518]
   Other proteins in same PDB: d5kvfe_, d5kvfl1
   automated match to d1dqdl2
   complexed with gol

Details for d5kvfl2

PDB Entry: 5kvf, 1.4 Å

PDB Description: zika specific antibody, zv-64, bound to zika envelope diii

PDB Compounds: (L:) ZV-64 Antibody Fab Light Chain

SCOPe Domain Sequences for d5kvfl2:

Sequence; same for both SEQRES and ATOM records:

>d5kvfl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d5kvfl2:

• d5kvfl2 is new in SCOPe 2.06-stable
  
• d5kvfl2 appears in SCOPe 2.07
  
• d5kvfl2 appears in the current release, SCOPe 2.08