SCOPe 2.06: Domain d5kvfl1: 5kvf L:1-107

Lineage for d5kvfl1 (5kvf L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5kvfl1: 5kvf L:1-107 [320517]
   Other proteins in same PDB: d5kvfe_, d5kvfl2
   automated match to d1dqdl1
   complexed with gol

Details for d5kvfl1

PDB Entry: 5kvf, 1.4 Å

PDB Description: zika specific antibody, zv-64, bound to zika envelope diii

PDB Compounds: (L:) ZV-64 Antibody Fab Light Chain

SCOPe Domain Sequences for d5kvfl1:

Sequence; same for both SEQRES and ATOM records:

>d5kvfl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsvgekvtmsckssqsllyssnqknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvkaedlavyycqqyytypytfgggtklein

Timeline for d5kvfl1:

• d5kvfl1 is new in SCOPe 2.06-stable
  
• d5kvfl1 appears in SCOPe 2.07
  
• d5kvfl1 appears in the current release, SCOPe 2.08