SCOPe 2.08: Domain d1cc0c_: 1cc0 C:

Lineage for d1cc0c_ (1cc0 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
   Uniprot P61586 2-181

8. Domain d1cc0c_: 1cc0 C: [32051]
   Other proteins in same PDB: d1cc0e_, d1cc0f_
   complexed with gdp, mg

Details for d1cc0c_

PDB Entry: 1cc0

PDB Description: crystal structure of the rhoa.gdp-rhogdi complex

PDB Compounds: (C:) transforming protein rhoa

SCOPe Domain Sequences for d1cc0c_:

Sequence; same for both SEQRES and ATOM records:

>d1cc0c_ c.37.1.8 (C:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqarr
gkkksgc

Timeline for d1cc0c_:

• d1cc0c_ first appeared (with stable ids) in SCOP 1.55
  
• d1cc0c_ appears in SCOPe 2.07