SCOPe 2.08: Domain d5j1aa2: 5j1a A:184-278

Lineage for d5j1aa2 (5j1a A:184-278)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5j1aa2: 5j1a A:184-278 [320502]
   Other proteins in same PDB: d5j1aa1, d5j1aa3, d5j1ab_
   automated match to d5c9ja2
   complexed with 6f8

Details for d5j1aa2

PDB Entry: 5j1a, 1.86 Å

PDB Description: antigen presenting molecule

PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d5j1aa2:

Sequence; same for both SEQRES and ATOM records:

>d5j1aa2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlywe

Timeline for d5j1aa2:

• d5j1aa2 first appeared in SCOPe 2.06
  
• d5j1aa2 appears in SCOPe 2.07