Lineage for d5j1aa1 (5j1a A:8-183)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 2507566Domain d5j1aa1: 5j1a A:8-183 [320501]
    Other proteins in same PDB: d5j1aa2, d5j1aa3, d5j1ab_
    automated match to d5c9ja1
    complexed with 6f8

Details for d5j1aa1

PDB Entry: 5j1a (more details), 1.86 Å

PDB Description: antigen presenting molecule
PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d5j1aa1:

Sequence, based on SEQRES records: (download)

>d5j1aa1 d.19.1.0 (A:8-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkele
tlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsfq
nnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Sequence, based on observed residues (ATOM records): (download)

>d5j1aa1 d.19.1.0 (A:8-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkele
tlfrirtirsfegirryahelqfeypfeiqvtggcegsflqlayqgsdfvsfqnnswlpy
pvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOPe Domain Coordinates for d5j1aa1:

Click to download the PDB-style file with coordinates for d5j1aa1.
(The format of our PDB-style files is described here.)

Timeline for d5j1aa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d5j1ab_