Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein automated matches [190183] (10 species) not a true protein |
Species Zika virus [TaxId:64320] [320471] (7 PDB entries) |
Domain d5kvde_: 5kvd E: [320472] Other proteins in same PDB: d5kvdh_, d5kvdl1, d5kvdl2 automated match to d1s6na_ complexed with edo, mes, na |
PDB Entry: 5kvd (more details), 1.65 Å
SCOPe Domain Sequences for d5kvde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kvde_ b.1.18.4 (E:) automated matches {Zika virus [TaxId: 64320]} mrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgr litanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgs
Timeline for d5kvde_: