Lineage for d5kvde_ (5kvd E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362223Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2362267Protein automated matches [190183] (8 species)
    not a true protein
  7. 2362287Species Zika virus [TaxId:64320] [320471] (7 PDB entries)
  8. 2362290Domain d5kvde_: 5kvd E: [320472]
    Other proteins in same PDB: d5kvdl1, d5kvdl2
    automated match to d1s6na_
    complexed with edo, mes, na

Details for d5kvde_

PDB Entry: 5kvd (more details), 1.65 Å

PDB Description: zika specific antibody, zv-2, bound to zika envelope diii
PDB Compounds: (E:) ZIKA Envelope DIII

SCOPe Domain Sequences for d5kvde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvde_ b.1.18.4 (E:) automated matches {Zika virus [TaxId: 64320]}
mrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgr
litanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgs

SCOPe Domain Coordinates for d5kvde_:

Click to download the PDB-style file with coordinates for d5kvde_.
(The format of our PDB-style files is described here.)

Timeline for d5kvde_: