SCOP 1.71: Domain d1ftn__: 1ftn -

Lineage for d1ftn__ (1ftn -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (12 PDB entries)

8. Domain d1ftn__: 1ftn - [32047]
   complexed with gdp, mg; mutant

Details for d1ftn__

PDB Entry: 1ftn, 2.1 Å

PDB Description: crystal structure of the human rhoa/gdp complex

SCOP Domain Sequences for d1ftn__:

Sequence; same for both SEQRES and ATOM records:

>d1ftn__ c.37.1.8 (-) RhoA {Human (Homo sapiens)}
irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

Timeline for d1ftn__:

• d1ftn__ first appeared (with stable ids) in SCOP 1.55
  
• d1ftn__ appears in SCOP 1.69
  
• d1ftn__ is called d1ftna_ in SCOP 1.73
  
• d1ftn__ appears in the current release, SCOPe 2.08, called d1ftna_