SCOPe 2.02: Domain d1dpfa_: 1dpf A:

Lineage for d1dpfa_ (1dpf A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (19 PDB entries)
   Uniprot P61586 2-181

8. Domain d1dpfa_: 1dpf A: [32046]
   complexed with gdp

Details for d1dpfa_

PDB Entry: 1dpf, 2 Å

PDB Description: crystal structure of a mg-free form of rhoa complexed with gdp

PDB Compounds: (A:) rhoa

SCOPe Domain Sequences for d1dpfa_:

Sequence; same for both SEQRES and ATOM records:

>d1dpfa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdvacgktcllivfskdqfpavyvptvfenyvadievdgkqvelalwdtag
qedydrarplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtarelakmkqepvkpaegrdmanrigafgymecsaktkdgvrevfematraalq

Timeline for d1dpfa_:

• d1dpfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dpfa_ appears in SCOPe 2.01
  
• d1dpfa_ appears in SCOPe 2.03
  
• d1dpfa_ appears in the current release, SCOPe 2.08