Lineage for d5jhrm_ (5jhr M:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229854Domain d5jhrm_: 5jhr M: [320458]
    Other proteins in same PDB: d5jhra_, d5jhrc_, d5jhrd_, d5jhre_, d5jhrg_, d5jhri_, d5jhrj_, d5jhrk_, d5jhrl_, d5jhrn_, d5jhro_, d5jhrq_, d5jhrr_, d5jhrs_, d5jhru_, d5jhrw_, d5jhrx_, d5jhry_, d5jhrz_
    automated match to d4qz7m_
    complexed with 6kf, cl, mes, mg

Details for d5jhrm_

PDB Entry: 5jhr (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 27
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5jhrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhrm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d5jhrm_:

Click to download the PDB-style file with coordinates for d5jhrm_.
(The format of our PDB-style files is described here.)

Timeline for d5jhrm_: