Lineage for d1rrpc_ (1rrp C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122094Protein Ran [52609] (2 species)
  7. 122108Species Human (Homo sapiens) [TaxId:9606] [52611] (6 PDB entries)
  8. 122118Domain d1rrpc_: 1rrp C: [32043]
    Other proteins in same PDB: d1rrpb_, d1rrpd_

Details for d1rrpc_

PDB Entry: 1rrp (more details), 2.96 Å

PDB Description: structure of the ran-gppnhp-ranbd1 complex

SCOP Domain Sequences for d1rrpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrpc_ c.37.1.8 (C:) Ran {Human (Homo sapiens)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev

SCOP Domain Coordinates for d1rrpc_:

Click to download the PDB-style file with coordinates for d1rrpc_.
(The format of our PDB-style files is described here.)

Timeline for d1rrpc_: