Lineage for d5jhsd_ (5jhs D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996287Domain d5jhsd_: 5jhs D: [320424]
    Other proteins in same PDB: d5jhsa_, d5jhsb_, d5jhsc2, d5jhsf_, d5jhsh_, d5jhsi_, d5jhsj_, d5jhsk_, d5jhsm_, d5jhsn_, d5jhso_, d5jhsp_, d5jhsq2, d5jhst_, d5jhsv_, d5jhsw_, d5jhsx_, d5jhsy_
    automated match to d1iruf_
    complexed with 6kg, cl, mes, mg

Details for d5jhsd_

PDB Entry: 5jhs (more details), 3 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 15
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5jhsd_:

Sequence, based on SEQRES records: (download)

>d5jhsd_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5jhsd_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5jhsd_:

Click to download the PDB-style file with coordinates for d5jhsd_.
(The format of our PDB-style files is described here.)

Timeline for d5jhsd_: