Lineage for d5g55a4 (5g55 A:726-1094)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1053 PDB entries)
  8. 2547405Domain d5g55a4: 5g55 A:726-1094 [320400]
    Other proteins in same PDB: d5g55a1, d5g55a2, d5g55a3
    automated match to d1he8a4
    complexed with 3qh, so4

Details for d5g55a4

PDB Entry: 5g55 (more details), 2.45 Å

PDB Description: 3-quinoline carboxamides inhibitors of pi3k
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5g55a4:

Sequence, based on SEQRES records: (download)

>d5g55a4 d.144.1.0 (A:726-1094) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlvlgi

Sequence, based on observed residues (ATOM records): (download)

>d5g55a4 d.144.1.0 (A:726-1094) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmm
lmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgi

SCOPe Domain Coordinates for d5g55a4:

Click to download the PDB-style file with coordinates for d5g55a4.
(The format of our PDB-style files is described here.)

Timeline for d5g55a4: